REGIONS INDEX  ·  10 REGIONS  ·  149 LIVE OPERATIONS ESC TO CLOSE
02 · MAP · WA
Schematic
KIMPILGASMWTGFEWHTMETPELSWTGTS
Regional Development Commission boundaries · DPIRD
SERVICES INDEX  ·  11 CATEGORIES  ·  5 GROUPS  ·  61 MINE-SITE PAGES ESC TO CLOSE
Can’t find what you need? Browse the full catalog or list your business in a new category. BROWSE ALL → GET LISTED →
MINE × SERVICE · PROCUREMENT BRIEF

Indigenous Civil Contractors at Ibanez.

Buyer-side sourcing analysis for engaging Indigenous Civil Contractors contractors at Ibanez — what to specify, how to compare quotes, and what to verify before you award.

LIVE OPERATION · Ibanez REGION · Pilbara SERVICE · Indigenous Civil Contractors

At a Glance

Operator
Not publicly confirmed
Commodity
Iron Ore
Region
Pilbara — Marble Bar
Distance from Perth
1,206 km
Nearest hub
Newman (~207 km)
Ambient peak
48°C (sustained 45°C+)
Typical SLA
Planned mobilisation 1-3 weeks (project-dependent)
Roster
2/1 FIFO (typical)
Insurance min
AUD $20M PL / $10M PI

Service Requirements at Ibanez

Civil works scoping for an iron ore operation in the Marble Bar district demands contractors whose capability is defined by earthworks complexity, not site familiarity alone. The Ibanez deposit sits within a BIF-hosted supergene goethite-hematite sequence — ground conditions that impose specific demands on bulk earthworks, haul road construction, and drainage infrastructure design, particularly where cut-and-fill profiles intersect variable laterite and ironstone horizons. The crushing and screening infrastructure footprint, together with the sealed ore haulage corridor running to Port Hedland, establishes a civil maintenance and construction envelope that requires contractors with demonstrated competence in hardstand, batter, and sealed pavement works at comparable Pilbara iron ore operations. Operational status at Ibanez is unconfirmed at time of publication; scope documentation must therefore be written in site-agnostic terms, specifying capability thresholds that are valid regardless of current activity level. Operator not publicly disclosed at time of publication. Operator confirmation via Minedex is required before scope issuance. Scope documentation should specify demonstrated earthworks delivery in BIF-hosted iron ore terrain, with minimum compaction and pavement standards referenced to Main Roads WA or equivalent, as a minimum performance threshold.

  • Pilbara site exposure: Minimum 24 months of active civil works delivery on Pilbara mine sites within the last 5 years, evidenced by signed project references specifying commodity (iron ore preferred), site name, and scope value exceeding AUD $500K per engagement
  • Heat-rated workforce and plant: Demonstrated service delivery in sustained ambient temperatures of 45°C, with documented heat management plans covering crew rotation, hydration protocols, and plant thermal load management; peak design tolerance to 48°C required for all mobile plant specifications submitted with tender
  • Self-sufficient crew logistics: Documented mobilisation capability to remote WA mine sites with no reliance on site-provided logistics; tender response must include a mobilisation methodology statement covering personnel transport, consumables, and equipment movement from Newman or equivalent staging hub

Site-Specific Operational Constraints

Conditions procurement must communicate to all bidders in tender documentation for Ibanez.

  • Environment: Marble Bar district sustains some of the highest recorded ambient temperatures in Australia; civil works planning must account for a sustained summer ambient of 45°C and peak events reaching 48°C, with red-dust abrasion from BIF-derived fines accelerating wear on compaction plant, grader blades, and filtration systems — RFQ must require contractors to specify filter replacement intervals and blade wear rates under Pilbara red-dust conditions
  • Logistics: Ibanez is approximately 1,206 km from Perth by road; Newman (~207 km) functions as the primary staging hub for personnel, plant, and materials movement — all tender responses must nominate a Newman-based or equivalent Pilbara staging arrangement, with fuel and consumables pre-positioned prior to mobilisation
  • Response SLA: For scheduled civil works packages, a 12–24 hour extended mobilisation window from Newman is the baseline expectation; for emergency civil response (batter failure, road washout, drainage breach), a 4-hour call-out from pre-positioned crew is required and must be documented in the contractor's mobilisation plan
  • Roster: FIFO compatibility is mandatory; tender documentation must specify roster pattern (minimum 2:1 or 8:6 cycle acceptable), with a nominated standby crew available during wet season (November–April) when access conditions and drainage works demand surge capacity
  • Camp/facilities: Operational status at Ibanez is unconfirmed; contractors must be fully self-sufficient for accommodation and catering — do not assume access to the 400-bed camp infrastructure associated with the broader Mt Webber operation; self-sufficiency requirements must be stated explicitly in the RFQ conditions

Contractor Capability Checklist

Minimum evaluation criteria for shortlisting Indigenous Civil Contractors at Ibanez. Each criterion must be verifiable via documentation submitted with tender response.

  • Technical certifications: Earthworks and civil construction competencies aligned to AS 3798 (Guidelines on Earthworks for Commercial and Residential Developments) or equivalent; pavement construction evidence referencing Main Roads WA specifications or site-equivalent standard; plant operator certifications current and WA-valid
  • Personnel tickets: All operators to hold current WA Construction Induction (White Card); plant operators to hold relevant high-risk work licences (e.g. dozer, grader, roller, excavator) under WA Work Health and Safety Act 2020 requirements; first aid coverage at ratio of 1:10 minimum on site at all times
  • Mobilisation SLA: Documented evidence of mobilisation to remote Pilbara mine sites within 24 hours from Newman or equivalent hub, drawn from at least two prior engagements within the last 3 years; mobilisation plan must address wet season access contingencies specific to the Marble Bar district
  • Public Liability insurance: Minimum AUD $20M per occurrence (Certificate of Currency required with tender response)
  • Professional Indemnity: Minimum AUD $10M aggregate where scope includes civil design, drainage engineering, or pavement specification advice (Certificate of Currency required)
  • Workers Compensation: Full statutory cover under WA law (WorkCover WA — Injury Management Plan required and must be submitted with tender response)
  • Site exposure: Minimum 24 months of civil works delivery on iron ore mine sites in the Pilbara within the last 5 years; references must confirm open-cut or DSO-type operations; BIF-hosted terrain experience is a scored differentiator in evaluation
  • Safety systems: HSE management system certified to ISO 45001 or equivalent; ICAM-trained incident investigation capability required; Indigenous employment and engagement plan must be submitted as a standalone document — this is a mandatory evaluation criterion, not a scored optional

Regulatory & HSE Framework

Applicable framework under the Work Health and Safety Act 2020 (WA) and the Work Health and Safety (Mines) Regulations 2022 (WA), administered by WorkSafe WA. Civil contractors operating at Ibanez are subject to the principal contractor obligations under the WHS Act 2020 where they engage subcontractors or labour hire personnel on site; the RFQ must require tenderers to confirm their principal contractor compliance posture in writing. Supplier prequalification for the operator is managed directly through its corporate procurement function; confirm current onboarding requirements before tendering. All contractors must complete site-specific induction via the operator procedures before mobilisation.

Sourcing Qualified Contractors

No confirmed tender activity for Indigenous civil works at Ibanez has been identified at time of publication. The regional pool of Indigenous civil contractors active in Pilbara mining is estimated at 8–10 firms capable of meeting mine-site civil scope requirements — a constrained market relative to the volume of concurrent iron ore project activity across the district. Procurement lead times for prequalification, Indigenous employment plan review, and mobilisation planning should allow a minimum of 8–10 weeks from RFQ issue to contract execution for this service category. Contractors with confirmed regional exposure include Djeleanna, Hicks Civil and Mining, Karlayura Group, Eastern Guruma, MDM Mining & Civil, Indigenous Mining and Civil Australia Pty Ltd (IMACA), MundaMurra, MGM Alliance, and Carey Group Holdings (noted as market reference only, not endorsement). Shortlist criteria should weight Marble Bar or East Pilbara district experience above general Pilbara exposure, given the specific access, climate, and ground condition profile of the Ibanez location relative to coastal or mid-Pilbara operations.

Sourcing Indigenous Civil Contractors for Ibanez?

Register to be notified as verified Pilbara providers are listed for this site.

Notify Me When Providers Are Listed
● FREE FOR BUYERS · NO OBLIGATION

Get 3 verified providers for Indigenous Civil Contractors at Ibanez.

Tell us what you need. We’ll match you with up to 3 verified WA suppliers and email you their details — usually within one business day. Urgent jobs are prioritised.

Free for buyers. We verify ABN, contact and credentials — we don’t rank by who pays.

Same service · nearby sites

Same Service at Nearby Mines